SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397667824|ref|YP_006509361.1| from Legionella pneumophila subsp. pneumophila

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397667824|ref|YP_006509361.1|
Domain Number 1 Region: 96-437
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.04e-27
Family Bacterial lipase 0.043
Further Details:      
 
Weak hits

Sequence:  gi|397667824|ref|YP_006509361.1|
Domain Number - Region: 461-610
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0337
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number - Region: 557-588,638-749
Classification Level Classification E-value
Superfamily ARM repeat 0.0777
Family MIF4G domain-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397667824|ref|YP_006509361.1|
Sequence length 752
Comment hypothetical protein LPV_2413 [Legionella pneumophila subsp. pneumophila]
Sequence
MFAEIPKIQEQLHDVLEYSQSMASLWMQSIDKSLEQTNKVTQSLINLNQQQVYPYPNILN
DAIEYTVDFMQRSILFWDIMRKRGNQYLKHEQEGQPPVLIFSYNMLMDGRHFERPVNYAL
VEITPPEGIQIDPAKRPYVIVDPRAGHGAGISGFKDASQVGLALRAGHPVYVIIFFPVPE
PNQTLVDVTAAHEKFLTEVALRHPQSPKPCLIGNCQGGWAILTLMAANPDVAGVAVVNGA
PLSYWGGENGKNPMRYIGGIWGGSWIAQMAGDLGNGKFDGANLVMNFEMANPKVTYWSKY
YNLFANLDKEEIRFLNFERWWGGFSLLNVNEMRGIIDNLFIGNKLVHGKIPLGQSGNNLD
LRNISVPVIIFCSEGDNITPPQQALNWVSDLYSNTLEIKLDGQVIVYLIHKSVGHLGIFV
SSEVAKKEHNQIIDLLNYIEHLAPGLYELKLNETKENPKSPPHYLAYIEERSINDIRKGQ
ENNVAIFNLVRMVSEYNAMSYDLFMAPIIRNISNEYTAELIRKLHPLRQNQYLLSDLNPL
VHPVSWISPFIRQNRIKISENNLFLTQQLNFSKLINALWDFFSASRDNTVELMFYAVYGY
IQLLAPFDPRRDMIVHSPEKDNQEKITQSIIAHISDGGVPEAILRILLLLVKIQGYIIGA
NLPDVIQKLRECNALKHLDKNGFKQIVHSQTIMIEHDPELAFNTIPHLLKSQEERSMVIQ
FIEDILKSLKVSPSEEYKKKFQRIKELLQNQA
Download sequence
Identical sequences A0A1P8N7V6
WP_014844361.1.1206 WP_014844361.1.17430 WP_014844361.1.23 WP_014844361.1.24881 WP_014844361.1.25422 WP_014844361.1.30122 WP_014844361.1.34671 WP_014844361.1.37078 WP_014844361.1.37792 WP_014844361.1.47329 WP_014844361.1.49404 WP_014844361.1.51024 WP_014844361.1.51991 WP_014844361.1.5252 WP_014844361.1.59692 WP_014844361.1.61570 WP_014844361.1.66942 WP_014844361.1.74052 WP_014844361.1.76246 WP_014844361.1.86462 WP_014844361.1.87225 WP_014844361.1.9568 WP_014844361.1.98163 gi|397667824|ref|YP_006509361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]