SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148642089|ref|YP_001272602.1| from Methanobrevibacter smithii ATCC 35061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148642089|ref|YP_001272602.1|
Domain Number 1 Region: 121-213
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000536
Family Calmodulin-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148642089|ref|YP_001272602.1|
Sequence length 219
Comment putative calcium-binding protein [Methanobrevibacter smithii ATCC 35061]
Sequence
MKKTHAILVAVIFLISVSAVFAADSSKEIFLGGVKFNVPSNGEFTPDNTGYHTDKFGIDL
IQDNSLPDEQNTIKNSSLTKMTLYHRDVLAIYSKSSDDFNVFYFSAGDKLFKASCKEDSD
IKKLQDIVKNSPNSTLTTEEFYARLGTNPYSDTFNELDTNHDGKLSIDEFEELTEYIMED
SFWDGYSPEEVIISEFESLDSNRDGFLSYDEFSDRFGFI
Download sequence
Identical sequences A0A1D2WU54 A5UJ56
420247.Msm_0029 gi|148642089|ref|YP_001272602.1| WP_011953634.1.44750 WP_011953634.1.59899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]