SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148643044|ref|YP_001273557.1| from Methanobrevibacter smithii ATCC 35061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148643044|ref|YP_001273557.1|
Domain Number 1 Region: 43-162
Classification Level Classification E-value
Superfamily Sortase 1.83e-18
Family Sortase 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148643044|ref|YP_001273557.1|
Sequence length 240
Comment sortase (surface protein transpeptidase), SrtA [Methanobrevibacter smithii ATCC 35061]
Sequence
MDKPKITTIVVIICIIILGLYAAGEVNYYSSKIAIEKNIDSPVVNIPTIGIEEKINNVSL
SQGVMHDAKSFTPTNGDVILSGHRTLQGSPFLRLNELNNGDVITLEWPGIGEVNYTVINK
TIVEPTARINTQSNGTHIYLITCDPIGSTAHRLIIEGELSDVGPINDKIIQNNPHESYAL
IITTAFLVIGLIFSYFYPKDNRIYILAIVLIISAILFYFYLFPIDSNIIYEKILWLNGGM
Download sequence
Identical sequences A0A1D2WV32 A5ULW1
gi|148643044|ref|YP_001273557.1| WP_011954213.1.11702 WP_011954213.1.34893 WP_011954213.1.37628 WP_011954213.1.44750 WP_011954213.1.59899 WP_011954213.1.77301 WP_011954213.1.93728 420247.Msm_0984 2004036112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]