SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148643234|ref|YP_001273747.1| from Methanobrevibacter smithii ATCC 35061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148643234|ref|YP_001273747.1|
Domain Number 1 Region: 265-297
Classification Level Classification E-value
Superfamily EF-hand 0.0000335
Family Calbindin D9K 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148643234|ref|YP_001273747.1|
Sequence length 319
Comment heat shock protein HtpX (Zn-dependent) [Methanobrevibacter smithii ATCC 35061]
Sequence
MKGTWKLKVRMALTMIILFTIVYFLVILAGSYLGIGGPSFYLIISLCIVAAQYWFGPTLV
KHSMNVRPLSESEAPNIHQMVEELACEAGVPKPQIELSEINVPNAFAYGRSKRSGHIAIT
RPILGLLDRNELKAVLGHEMGHIKHNDMIVTAIVSLVPMICYYIALSFMFSRNNENNAGI
IIGILGYVFYLIGQLLVLFISRTREYYADEASVEYGNRPADLVSALYKLSYGAARCDDET
IKDVNTVRAFFVNDVDNATRDLNDFRQIDFDGDGSISEEELRELSQRNVDVSTSNKIMEL
FSTHPDSLKRVKRLSELEN
Download sequence
Identical sequences A0A1D2WTA9 A5UMF1
gi|148643234|ref|YP_001273747.1| WP_011954332.1.44750 WP_011954332.1.59899 420247.Msm_1174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]