SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148642772|ref|YP_001273285.1| from Methanobrevibacter smithii ATCC 35061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148642772|ref|YP_001273285.1|
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-27
Family BPHL domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148642772|ref|YP_001273285.1|
Sequence length 136
Comment hypothetical protein Msm_0712 [Methanobrevibacter smithii ATCC 35061]
Sequence
MAFLDKVIGHGDVSEEMDKDYVSEFFFDDEEVIQSYQFIRDQIILTNYGIYEVDVQGLSG
KKVEVKFFPKDTIKTISFETAGTLDFDVDIKIGVTNNTVVNVDGAAYSEPLSFKVPSSQA
AEAKEVVRLVKEHYLF
Download sequence
Identical sequences A0A1D2WU13 A5UL39 D2ZNF5
gi|148642772|ref|YP_001273285.1| 420247.Msm_0712 WP_004032471.1.44750 WP_004032471.1.48459 WP_004032471.1.52714 WP_004032471.1.59899 2004005839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]