SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148642963|ref|YP_001273476.1| from Methanobrevibacter smithii ATCC 35061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148642963|ref|YP_001273476.1|
Domain Number 1 Region: 6-249
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.79e-124
Family Methyl-coenzyme M reductase gamma chain 0.000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148642963|ref|YP_001273476.1|
Sequence length 268
Comment methyl-coenzyme M reductase, gamma subunit, McrG [Methanobrevibacter smithii ATCC 35061]
Sequence
MSYKAQFTPGETKIAENRRKHMDPTHKFKKIREVSDEGLVRILGHRNPGENYKTVHPPLD
EMDMGGDIIREMVEPTPGAKQGIRVRYIQFADSMYNAPAQPYDRARTYMWRYRGVDTGTL
SGRQVIEIREQDLEKISKELVETDIFDPAKSGMRGATVHGHSLRLDENGLMFDALQRYVF
DEESGHIMYVKDQVGRPLDEAVDVGVPLEEDYLKDITTIYREDNVGLRSDDEAVDIVETI
HSSRTKGGYGLGVFSKDLKMRLGEYDGE
Download sequence
Identical sequences A0A1D2WUW7 A5ULN0
420247.Msm_0903 WP_011954159.1.44750 WP_011954159.1.59899 gi|148642963|ref|YP_001273476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]