SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146296494|ref|YP_001180265.1| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146296494|ref|YP_001180265.1|
Domain Number 1 Region: 122-344
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.22e-32
Family Multidrug efflux transporter AcrB transmembrane domain 0.01
Further Details:      
 
Domain Number 2 Region: 823-1022
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.7e-20
Family Multidrug efflux transporter AcrB transmembrane domain 0.0081
Further Details:      
 
Domain Number 3 Region: 519-745
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000000523
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146296494|ref|YP_001180265.1|
Sequence length 1026
Comment MMPL domain-containing protein [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MRVILKRPWLGTIIWAILTVIFVVTMPDINKIVRLKGEPKISQEYPSQVAAALEKEYQGV
PKDKKLSTVAIVFYDKNGLSNKDIEAIKKIIYGLDNSKERYNIENISTHFKNPELKNYYV
SSNNKVVLASIQADKSRREIIEIRNDIYKFIESVQKPKNLEVYLTGGDLITQDFVKASED
GVKKTDVITIIFIIIVLVLVFRSPVTPIVSLLTVGVSFLISLSIVGHLADKFNFPINTFT
RTFIVVSLFGIGTDYNLLIISRFREELANGKNVDDAILTTYKTAGKTVIFSCLTVFAGFS
AFAAASFNFFRAMTAIAISVLVLLLVLLTLVPTVLKIFGKNLLWPFNKEIHHTHSKLWET
AARLSTKYPYVVLTTVILILIPFLLSVRGDLSFNTLNELSEKYKSVKGFNIISKNFSSGK
TFPVTIYLKSNKNLATSDALSDIEKITEILSKQKGIKDVYSVTRPEGEIIKQFTLSNQAD
TVIKGIDSLRDGLLKVNNAIETINKNLNMSTKEFDVQKLVTGISQLENGVYELKISLEKL
NSGFEQGLNGSKKIYDGLNKLSIGSSKLSEGFKEFYFEYTRSINKVKSELQGFDVNQIEL
LLTGINTANNNLKALSNKYPEISRDINYIMASEILSKIETEANKFAPKLKEFSSEYEKIS
AQINEADKALKLISNSINSITSASKQLADAQGKVLSGYYQIDKGQKQIISGVNLMYSKLQ
EFDKQKEQILKKVDELQTGFTSLKSALLQISDALNKMANSMQSMKGYFEGYKTTNIFYVP
PEAIKSSSFKKALDSYMNKDRTITKIILILDTNPYTNKAIDIVDNVEKVLNNSLEFINTK
FVSVGVGGISSSNHDLKSIYFKDFKTLRLIMIISIFILMFIISRSIFNAAIMVVIVFVDY
YLALSITEMIFKGIFEYEALNWAVPFFTFVVFLALGIDYSVFLLIRFYEYRNLELSEALK
LTSANIGHVVTSAVIILAGTFAAMLPSGILTLMQVSICVVIGLVLLAFFLLPFLYNSLMR
IKRDVI
Download sequence
Identical sequences A4XJI9
gi|146296494|ref|YP_001180265.1| WP_011917010.1.85531 351627.Csac_1474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]