SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146297741|ref|YP_001181512.1| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146297741|ref|YP_001181512.1|
Domain Number 1 Region: 341-375,408-660
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.01e-28
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0013
Further Details:      
 
Domain Number 2 Region: 67-195
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000000000131
Family Sensory domain of two-component sensor kinase 0.0095
Further Details:      
 
Weak hits

Sequence:  gi|146297741|ref|YP_001181512.1|
Domain Number - Region: 218-285
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0902
Family Sensory domain of two-component sensor kinase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146297741|ref|YP_001181512.1|
Sequence length 678
Comment methyl-accepting chemotaxis sensory transducer [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MKQLHKFKKVSIKISGSLKTRITLWFIIISLIPLLVFLIFSLSLIEKNAQKELKSRLEAA
HNVAIQEIERYQKLSQDYATLISSNNLLKEAILKKDHLRLVQVISPLASQMNIDQIAVTD
SNGILIGRSDILSRYGDNWKENYLVKCGLARLRYTTIEKSGDDIYIKSVSDVVTEMSANN
MRVIGTVIVGYKLDKRFVENLSRLTKMNVILYPANSPNKYISQSNSQKLGGIIKKETLQK
AMSGEYEYVIGKTGTKNDSYSFVVIPVRKANNIMPVAALAILTNNLLVSNFVTSSIRFSI
LLFGLTLVLVIIVSMFIANRITRPINKLVDSARKVASGKFDIQVDDSVVSSDEIGLLARE
FSKMVKSIHTFVTNIDQTVSTTQSYIDRLNSIATDSAKTNEITAAQIKEIIELAEKQKKA
FEEVSNYITEIEQQVQNTFKVFRTIEEGITSVVDTTYKEEESIQNLIKYMYTVNETINQV
ASDLSEAMQNYKSIVSASEYISKLAEQIKIISLNVSIEAAKRDVPSFGVIASEISRLSQT
ADSFAKRISESIEKSLLTFNKTNKRLEESMKVVKAGVEVAKKSTVSLSKIKETNTAMKER
ISKISSEISNQQEKILNINNTLKLQTQTTLQYFKTLSSIKDVFQKQIRSVDKLIEQFKDV
HEGVVKLAAISIKAGEDT
Download sequence
Identical sequences A4XN36
351627.Csac_2756 WP_011918238.1.85531 gi|146297741|ref|YP_001181512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]