SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|127513899|ref|YP_001095096.1| from Shewanella loihica PV-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|127513899|ref|YP_001095096.1|
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-43
Family SMI1/KNR4-like 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|127513899|ref|YP_001095096.1|
Sequence length 133
Comment hypothetical protein Shew_2971 [Shewanella loihica PV-4]
Sequence
MHDLIEQLRELSETVPVPLELPSFDQLVEVEEQILIPLPAELKEYLLYASDVIHGTLEPV
TAADPYAHTYLPEVTSYAWSIGMPREYIAICQQGDDFYCIDQEGQVMLWQDGELAEESWE
SFWQWVEEVWIPA
Download sequence
Identical sequences A3QH89
gi|127513899|ref|YP_001095096.1| WP_011866768.1.33760 323850.Shew_2971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]