SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|127514475|ref|YP_001095672.1| from Shewanella loihica PV-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|127514475|ref|YP_001095672.1|
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000403
Family Coronavirus S2 glycoprotein 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|127514475|ref|YP_001095672.1|
Domain Number - Region: 61-196
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0144
Family Chemotaxis phosphatase CheZ 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|127514475|ref|YP_001095672.1|
Sequence length 216
Comment hypothetical protein Shew_3547 [Shewanella loihica PV-4]
Sequence
MRKLLTAATLGAVVMLSGCQSAYYGAMEKVGYHKRDIMVDRVNAAKESQEEAQAQFSSAL
EEMQALLNHDGGDLQSAYEKARDEYESSQEAADEVSSRIDKVEDVAEALFDEWQAEIGEI
SKASLRRNSETKLRETRRSYEQLVRTMRRAESKMPPILTAMKDNMLYLKHNLNAQAIGAI
KGEFASLQTDISSLIKEMNKSIAESNRFIESMEGNK
Download sequence
Identical sequences A3QIW5
WP_011867342.1.33760 gi|127514475|ref|YP_001095672.1| 323850.Shew_3547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]