SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|120434573|ref|YP_860266.1| from Gramella forsetii KT0803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120434573|ref|YP_860266.1|
Domain Number 1 Region: 191-547
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.16e-73
Family Glycosyl Hydrolase Family 88 0.053
Further Details:      
 
Domain Number 2 Region: 9-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.7e-30
Family Thioltransferase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120434573|ref|YP_860266.1|
Sequence length 682
Comment hypothetical protein GFO_0204 [Gramella forsetii KT0803]
Sequence
MDNNQEKHTNDLIHESSPYLLQHAHNPVDWKPWNDENLDQAQKENKLLLISVGYSACHWC
HVMEHESFEDEAVAELMNVNYICIKVDREERPDVDQVYMNAVQIMTGMGGWPMNIVALPD
GRPVWGGTYFRKEQWMEALQQISHLFNSQPEKLLEYAEKLEQGLKQIQIIEPVKEQNKPH
KDFFIPIIEKWKRSFDPKNGGYQRSPKFMMPNNYEFLLRYAFQNSDKELKSHCLLTLNRI
SWGGVFDPIEGGFSRYSVDEKWHVPHFEKMLYDNAQLVQLYSKTYKITKNNWYKEVVKQT
LQFISAEMTDESGAFYSALDADSANENGKKEEGAYYVWTKENLKSILGNEFEIFSEYYNI
NNYGKWEADNYVLIRTKSLDQLSQDLDIPREDLQQRIAQCNLKLKKAKSKREKPGLDDKS
LTSWNALMISGYTEAYKAFRNGEYLEAAEKNAAFILENQLQENGRLYHSYKNGKSTINGY
LEDYAFSISAFLDLYECTFEQEYLGRARNLIDVTDKDFTDSVSGLYFFTSDKDRELVTKT
IEISDNVIPASNSEMAKNIFRFGKLTGDMKYVGKAEKMLQIVMDKIPEYPQSYSNWLDLM
LNFTNPFYEIAITGENYKNLAETFQEDYLPNTVLAATDSKSNMSLLKDRLVNGKNLIYIC
TEGSCQLPAASKDEALQHISQV
Download sequence
Identical sequences A0LXU7
gi|120434573|ref|YP_860266.1| WP_011708130.1.75286 411154.GFO_0204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]