SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152991841|ref|YP_001357562.1| from Sulfurovum sp. NBC37-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152991841|ref|YP_001357562.1|
Domain Number 1 Region: 122-469,509-566
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 7.85e-62
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000215
Further Details:      
 
Domain Number 2 Region: 9-102
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000000000000384
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152991841|ref|YP_001357562.1|
Sequence length 571
Comment cytochrome cd1 nitrite reductase [Sulfurovum sp. NBC37-1]
Sequence
MKLNRILGLAAVTSFAATMAIAGTSNMDFAKVFEKECQGCHGPIHQGGVGSDLRPKALKK
KNAEMLAETIMEGRENTAMPAWNATFSKDDAAGMVHWLMDWKNTVELKLDFDQVHKTWTK
LADRDALAKKYPKATDVKDVKDITFATERDASLVDFIDSTTGKVLSRHKAGFAVHVTVTN
KHDPRYAYCISRSGKLTMFDIAAPGQPALATVQVGQESRGLAVSPDGKYVMAGNYNPGGA
VLCDAHTLEPLKVYDTSRVIDTDGQIGPSRVAYIADTPYGPYFSFALKDAGHVYVVDYSK
PDFPIVGDIPNIGKVLHDAFLNENEGEDFGRYVQVASQGSDLMGIVDQKTMQLAAKVHTG
KKSKPHPGQGSSWFNKKMGKQLNATNSMNFGSVVIWESPSWKIVKKIKTSGGGLFVGTGE
HTPWIWSDCVLGKPDKYNEVHLINKETLETDRIIKVGKTEGQLIDAKSGKVLQTWDATQH
EKVPMNEKTFGKEKIMPMPDHLGKALKEGVQPRLLHAEPANHGKWTMISEWTTGRIGIYE
SETGKFVKYINNLTTPTFTYSVEHRQHIPGA
Download sequence
Identical sequences A6Q6U6
WP_011979938.1.96465 gi|152991841|ref|YP_001357562.1| 387093.SUN_0245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]