SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152991845|ref|YP_001357566.1| from Sulfurovum sp. NBC37-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152991845|ref|YP_001357566.1|
Domain Number 1 Region: 12-360
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.49e-35
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152991845|ref|YP_001357566.1|
Sequence length 366
Comment heme d1 biosynthesis protein NirF [Sulfurovum sp. NBC37-1]
Sequence
MKYLLSVLLLGTTFFSTALSAKEKYFVVERESESVAVIEDGLAKRHMEHMHNMNHGIIKF
DGDDAYLISRDGYIVKFDPKTEKVEAEYKTSKSAIGFVIGKNYVAVANYDDKSVDILTRD
LKPIDKIVTGSKNVGIKIYKDMIIFAQMDNDKVTVLKDENAGKGTPKFKIVKEFKVGKMP
FDAMIKDNTYIVGFFLSKAFGVIDLDKMTYSQIKVTAEDNKPVLKVPHFGFWSLSDDRTF
IPAVGDNAVMVYDNNFNFIKNIETQGLPVFTSLSPDKKYLAVTYSGKDFPTIQIIDTKTL
KIIKTFTFKGKVLHVRWSKEYPSLYVSVNDANQVNVIDTDEWFLEREIFQVKHPSGIFLY
ESKKKK
Download sequence
Identical sequences A6Q6V0
WP_011979942.1.96465 387093.SUN_0249 gi|152991845|ref|YP_001357566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]