SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152992771|ref|YP_001358492.1| from Sulfurovum sp. NBC37-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152992771|ref|YP_001358492.1|
Domain Number 1 Region: 289-388
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000000118
Family NlpC/P60 0.024
Further Details:      
 
Weak hits

Sequence:  gi|152992771|ref|YP_001358492.1|
Domain Number - Region: 187-300
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00222
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152992771|ref|YP_001358492.1|
Sequence length 445
Comment hypothetical protein SUN_1180 [Sulfurovum sp. NBC37-1]
Sequence
MYRKINFVIFIIFSFSTLLPAQYLLKESTRKPSKIDHMPKNKVADMRRIPQDPAYYAKQI
KLWPKARQKRSDKAFNRKYFKPWRLKKLDIPMKDFAWEVRFVTKNKIYTENGKQIPASTY
KKWIRNANYKHKNAKRYKAITTERTNVRALPTSTPFYLDPHRVGEGFPFNYNQNSALHMN
VPVFVSHFSKDGRWAFVRASYAFGWVKVSDIAFVDQKFIRAFRNGKYAITIKDDLRLYDE
NGKEVSFVKLGTLFPVSKDGKHYLAAKRDRNGKAQIEKIAVSNPKIIAKKPLPFTPHNVA
KVAKEFYNEPYGWGGGYGCRDCSATTRDFLGVFGIFLRRNSSKQAKDGQSIPIKGIPRQA
KKKKIIREADPFRSLLYVPGHIVLYLGEYKGEPVIMHTYWGIRKKDGSKLVTGRTIITST
EPGKERRDTKESSRLINTLKTIVKF
Download sequence
Identical sequences A6Q9H6
WP_011980868.1.96465 gi|152992771|ref|YP_001358492.1| 387093.SUN_1180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]