SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152992596|ref|YP_001358317.1| from Sulfurovum sp. NBC37-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152992596|ref|YP_001358317.1|
Domain Number 1 Region: 40-238
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.85e-34
Family Nuclease 0.061
Further Details:      
 
Domain Number 2 Region: 294-475
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.07e-24
Family Nuclease 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152992596|ref|YP_001358317.1|
Sequence length 531
Comment phospholipase D/transphosphatidylase [Sulfurovum sp. NBC37-1]
Sequence
MSRFLHTAVLAATLLFLSACNHSSPASLPPKQKSFTKLPKGKAPLLHYLARTDRPLGKHS
AFYPLEKPMDALAARIFLIDHASTSLDVQYYIYEDDRTGNFFSYHLLKAAQRGVKIRILL
DDLITTGKDREFAILAAHPNIELRLFNPNRLRRSFRNLALLFDIDRLGKRMHNKALIADG
TSAIIGGRNIGDVYYAADNEILFLDYDILTIGKVVPDIYRSFDIYWNSKEAVPSDEVLDN
GSIDKTEYQIVAKNLEKEVREFQHSPIGTALSRSNFLKKISQKTLQMTVAERTDFYYDYP
EKVTTNENDKQTHISSQISEDLKHINHDLIIVSPYFIPGEELMKELRALRKKHIKVTVVT
NSLASTDVFPVYSGYRWYIRDLVQMGVVLYELKPTSLKTALKKKKIKKTFSASLHTKMMI
LDNDRLVVGSANVDPRSDKLNTETLMIISSEKLASGHKKVLSAILNEKYFYRVTWGEHPL
EPEDDGMVQYGPVWHTLENGKEKVYYTPPRAGFLKTLGTDILSLFPIEGYL
Download sequence
Identical sequences A6Q901
387093.SUN_1003 WP_011980693.1.96465 gi|152992596|ref|YP_001358317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]