SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152992936|ref|YP_001358657.1| from Sulfurovum sp. NBC37-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152992936|ref|YP_001358657.1|
Domain Number 1 Region: 23-214
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.41e-35
Family Phospholipase D 0.055
Further Details:      
 
Domain Number 2 Region: 271-445
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.18e-27
Family Nuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152992936|ref|YP_001358657.1|
Sequence length 500
Comment phospholipase D/transphosphatidylase [Sulfurovum sp. NBC37-1]
Sequence
MASQCHTQHIRDKTMPIKQTPVWADIFKSPLPLNKGSSFYSLENPVDAFAARLYLIDHAT
ASIDVQYYIYKNDKTAAELSYHLIKAAERGVKVRMLVDDLTTSIRDKDVALLAAHPNIDV
KLFNPNRIRGTFRNMALLLDVSKLGKRMHNKVFIVDRYAAILGGRNIGDEYFAMSKDIDF
LDYEILVMGKVLAKIYRIFDIYWNSPLSHFYEEIIKSDVSDKAYKRSVKKITEYHHAFAN
TRLAKKLPFSRFTHKVEVAHVTLYPAKMTSLYFDLPQKVVSDPNDIETHLSKSLKNALDS
TKKEVIVISPYFIPSPMMMETFKKLRAKDIKVTVITNSMASTDVTAVYSGYKTYINPLLK
MGVALYEFKAQQNEAIEKKYFKFNRLSLHTKMIIIDSDILLVGSANLDPRSDKLNTEILM
LIKQSQLIGHIKSKIKKIMDRKHLYRLSLMKLSEHSKRMCIVWESQEDGKIKRYKMVPKA
GLFRRIGVYLFSLLPIEGYL
Download sequence
Identical sequences A6Q9Z1
WP_011981033.1.96465 387093.SUN_1347 gi|152992936|ref|YP_001358657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]