SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479202534|ref|YP_007831125.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479202534|ref|YP_007831125.1|
Domain Number 1 Region: 89-219
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.94e-30
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 15-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.82e-21
Family GntR-like transcriptional regulators 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479202534|ref|YP_007831125.1|
Sequence length 230
Comment transcriptional regulator, GntR family [Roseburia intestinalis M50/1]
Sequence
MEENRFMTDDLTLNMDAYLPLRDVVFNTLREAILKGELKPGERLMELQLAAKLGVSRTPI
REAIRMLEQEGLAVTIPRKGAEVAKMTEKDMEDVLQIRDALDELAASIACEQMTKEQLDT
LTETMHEFEESTKSKDLKKIAAADVQFHDIIYQATGNPKLVNMLNNLREQMYRYRVEYLK
DERNYPTLMREHSEIVEGLMTKDKGRVTEAMHKHVKNQVVAVKEMIREQE
Download sequence
Identical sequences A0A1Q6S9T7 C7G763 D4KMI2 D4KZ55
WP_006855867.1.14300 WP_006855867.1.8661 gi|479202534|ref|YP_007831125.1| gi|479147993|ref|YP_007778422.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]