SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479204195|ref|YP_007832786.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479204195|ref|YP_007832786.1|
Domain Number 1 Region: 313-389
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000381
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 2 Region: 172-264
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000628
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479204195|ref|YP_007832786.1|
Sequence length 393
Comment Fibronectin type III domain [Roseburia intestinalis M50/1]
Sequence
MKKMKTYILGMVLAFAMILLPQNVSAATQIPVTAVEDITDVMAVGSTNIKVPTGEYSNVV
QFSLNKPSYVYVSAYSTVMHEDYDSLGAIEEFAVYSDANCSNLVTGDEVTVVWGNERKSK
YLCLDAGNYWICFAKTKNGSYNDDSYGEFRLSVAAQYLNVTGTKNGSWGRAKQITTDKKV
TGFLSSNTRKSWFKFKVSGDTTARLNLSLENPLGESVFESSKTGVTLYRSNHNVLERMNI
AENYYSSACSKEVTLKSGTYYIEIAGSEAYKDSWDPTKLKKTGVNNMGVVNLKITTVKKT
KISKLSNVKGKKAQVTYNKVSNAKGYEIQYSTDKKFKKGVKVKKANAKTTKVTLTKLTKG
KKYYVRVRAYRVDEDDNRVNGSWSEAKSVKITK
Download sequence
Identical sequences D4KS93
gi|479204195|ref|YP_007832786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]