SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110667170|ref|YP_656981.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110667170|ref|YP_656981.1|
Domain Number 1 Region: 77-376
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.97e-18
Family Pectin methylesterase 0.059
Further Details:      
 
Domain Number 2 Region: 417-725
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000203
Family Pectate transeliminase 0.049
Further Details:      
 
Weak hits

Sequence:  gi|110667170|ref|YP_656981.1|
Domain Number - Region: 1289-1356
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00837
Family Transglutaminase, two C-terminal domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110667170|ref|YP_656981.1|
Sequence length 2885
Comment cell surface glycoprotein [Haloquadratum walsbyi DSM 16790]
Sequence
MMITSVMAAGVAFTGSTAADAPPDSPTTDPGNLQVSLLNESNDANVTFGVNTTSKTINKT
NATDSDVAVGSVNSDLDNTAKAIQFAIDNATTEYSTVRVGSGIYNGSVSIDVNDLTLEGA
DGASSTIIGQSSVAVTSTTPNVEIADLRIQNPDGSRAVMVTDDATDVVIQDNTITNINTD
NDATQPRGILVIGLDGGDSADGLEIRNNTVTNIESNGGDQAHGIQILEESNGGGLIENVV
VDGNTIEDISDIRSTVAVNFNGHIEGEITNNDISGLNTEGNPTNASPGAGFTQVIALNAG
GNAVDGPQNVTIEGNDISDIETTEPEEAINFAPPFHIIIGSDADADTISIENNDFSADSV
DPRGDVYIGSDGTGDFDLQGALGANTFTPSAVQGAAGGNRILVPETGVDVVNVDQNTGFD
QIQPAVDGANPGDTIEVKSGTYNDSVTINVTGLTLEGPNAGTAGNNSNGRGPEATIQQGV
QILSDNVTLTGFDVTNDDTNGILLGTNTAPSNVTISDTVVRDISGGTGGDKSAGNGVNLQ
FNGAVNETSTDVVITDNLIINVTTQGDNSDEDAIGIQTLPRGNDVEDLQITDNVISDIEP
ADNDGRSEARGISIDTQFENTSNGDRGNFGQATNLTVKNNDIDSLTADFARAITLFEDKQ
GPNSGSTSGQPVGPVNFTITENRVTGVNSEGTNGNDFRDIALFVGASQTLGPDHSVSANT
FASGAVVRFADTSQAGEEFDPDSADALDTSGNKFTNDSIRFYYSDATAEADLTAVRNENT
FSRNVIANDTLIFPSASVNPAASVTTSSVAAGDQSVTADINFSRTAGGNVTLDVQDSSDN
SITDQLTSTSSNGTVTVDLSRSVSGEDIDVVVFETDDTAVELDRATVTVPSPPDPDPANF
GVSLSTPDTVTAGETVTATATAENTGEQSGSKSISFSVDGEQADSTSVSLDGGASQAVSF
SYDTTANDTPSVTLQVASDDDTASSTVSVSAPAAAAFDITTVDTPETVTAGDTVEVAATV
ENTGEQSRSQSITLDVGGTQVDSTSVSLDGGASQEITLTYTTTTDDAPAVELTVASDTDS
TTRSVSVTEPAVSSFTVASIDTPDTVTAGEEIAVSTTIENTGSESGTQPVSLLVDGSEET
SRSVTLAAGEQTTESFGYSVASSATTQQLNIAVETANDTTTSQVQVSGALNRTPLRLQAN
ETAVVRGETVEFTVTDPTGSPVDASVRVLDTTQQTDDDGTTTIPIETVGRLDAVATKTAT
NTTEFAPASISITASAPALRVDRQTVSFGDVAVGDTATVEVTVSNPSPTRLDVGSLRVTG
PGASAVTLDQDAVSESIPANGDRTLEVAFTPQSRGTISPTLSVDDQTVSISGTGTQPELN
IDTELPIELTTAPDSSATTAVTLSNDGNAPVTTQLTSGESFTQPDAVTVAAGGTETFDIE
FAPQASDTSTISTQLTLTPANETLSSTTIPVVGTITDREVTARTTAVSFDAVPVNETQRT
GVVVDNTGTTTETLTATTDTDAFELGDDDREFTLAPDTQAFLSVAATPAESGDISGSLSI
ESTDGELSDSVSLSVTGQAPELSVDASDPLSFGPTPQGSTATQVIDISNPGDGTLSVRVD
QQLSETAFAVPIDRSLSVPTGESRRLPIRFTPQTAGQATAELPLVTNDPEAPQRSITLQG
DGVATDVRLSTGQLEFGIVGVGNATTETLTIANNGSSFTISDVSVEGTAYETTTNLAGTT
LENGDATEVGVRFEPEVGGTQTGTLTVSGSTDTDSTTLSAALTGSGQTADLRVGAQTLRT
GVTTTDGQTTGSVIIENTGPAGSQLSIDDVELTDTEQFSLRSDGVTEGTVISGQSEATLP
VTFTPAATGSSVRETELTIDASSGQESFTRTLDVAGTVTSPDPTVSTDELAVGEIPTGET
TRRTITVSNDGGEPFSITAVDAGASGVRAEQVGSGEIVAGEERTIAVVVNRSVGGSFDTT
VDISTTTEETLTTSLTGTIATPTFALASESVSFEDTPTRSATQRSVDIENTGDVPLVVTA
PTIEGSNADAFSLLSGDRELRIAAGSSETVTVGFNPTTAGDKTAILSIRPRNDPAVETTQ
QLALSGRATESDVGLTNPAVSFGALNPETTQTRSVSFVNDGTAPVEITGASVTGTDSGAV
AVDGLQQQRVQPGETTSFGITVDTANRERGTLAAQVAIATTGETVTAPVSATVASPELTI
SPSTGATVSTVRIGETTTTNIQVANDGNAPLEVTAVSTTGGDAAAFNVVNRPTGSISSGS
SDRATIEFDPAALPNAATRAQGTPLDASTSLEVITATGERRSISLSGTAETGALTTPRTF
QFGTTTIGETRTQSFTIANSPSATTPVDITGVSISGRDAGAYDITLSDSDLPRTLAPGES
ATANVRLTPASPGQKFATLTVQTADPRQSVSKVGLSNTDTVYAVEYGSIDVQYINPTPGQ
SLAINVDQGLRAANATLVSTSSVVNTSDDYAVNYTFGVTPSAVGADASLQEAREGEVAVQ
YLDATTTAQPAQFDESTLQIEVSKTAIAAQNASPENVTVYRENDGRYEPIDTTLLFETTR
GYVYEVTTGSYSVFVVGVTDETTDGETGGVDDGDGDTGGVDDGDEDTGGVDDGDGDTGGV
DDGGGGGGGDGDIGGGGNGGGGGFFGPARQATEIATETEAISGRQVSLTGLANRNDQVRA
ITLEFSTPTFQEVTADVFADAPEGYPTQRATSVSAVDITVPESVRGEPATVIISLNRDHV
QEVGPAPEDLQIERFTGSQYQPLSTEVVSVDSEEVTLRAETPGFSLFIISAPVSGAVTTT
PTLTPTPSSTVTQTVTSEPPTPTPDPTPTPETPTSTPSVIPGFGLIVALVAIISLTMILR
YRRRQ
Download sequence
Identical sequences Q18DY9
362976.HQ1197A gi|110667170|ref|YP_656981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]