SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110667172|ref|YP_656983.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110667172|ref|YP_656983.1|
Domain Number 1 Region: 69-207
Classification Level Classification E-value
Superfamily Subtilisin-like 3.67e-21
Family Subtilases 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|110667172|ref|YP_656983.1|
Domain Number - Region: 340-385
Classification Level Classification E-value
Superfamily EF-hand 0.0144
Family Calmodulin-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110667172|ref|YP_656983.1|
Sequence length 409
Comment subtilisin-like serine protease [Haloquadratum walsbyi DSM 16790]
Sequence
MLYNPVADQIIARTNTQTATESNRYAALVSNIETQHVSLIIQHTAGPADDTIEVSVNSNT
LSGMERNIPESSLVAPADVPETFSIAAYEVSASRVAPYSSRGPTDTGQQGIDVTGHTNIG
VEKGLYGVTPFRFSGTSASAPYVGGVAALVEQADSGNPSPATLATTLRSASDDIRVPGDD
TVSGSGVVNAVDAVESVSSVSITPTPTPTPTPTPTPAPTPTPVSTPTPTSTPTPTPNSDI
TVTRSDTATEVTPGTEITITTQIANVSGSVSVNTNYTPPVQSANITDITVNTKTVNPVLS
EANQNGSTVTAGDVGTDATVTITEELIVSEELNVTHSITGDVSAGETTIAFDPVTVAVTE
TEPDSIVDEYDANNDGDISITELGQAGRAFASGELTITELGEIGTAFAS
Download sequence
Identical sequences gi|110667172|ref|YP_656983.1| WP_011570493.1.31310 362976.HQ1200A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]