SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110667541|ref|YP_657352.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110667541|ref|YP_657352.1|
Domain Number 1 Region: 50-234
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 8.77e-46
Family NADH oxidase/flavin reductase 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110667541|ref|YP_657352.1|
Sequence length 235
Comment nitroreductase [Haloquadratum walsbyi DSM 16790]
Sequence
MSLISIVNIDSTCIINSVFFTRGFRGRYVCSLCRDNMEGLREEVAEHRAPEEDIDSLFVN
RWSPRAMTGESLDEAQYMPLFEAARWAPSSYNNQHWRFLYATREDEEFELFADLLIEANR
EWAEDAGVLVTLVSKETFDHNGEHARTHSFDTGAAWQNLALEATRQGLVTHAMQGLDYEA
AAEQLNVPDGFSVECMIAIGEHAPPETLSDELQEREFPSDRKPVDEILHRGGFDD
Download sequence
Identical sequences WP_011570862.1.31310 WP_011570862.1.96088 gi|110667541|ref|YP_657352.1| 362976.HQ1582A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]