SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110667965|ref|YP_657776.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110667965|ref|YP_657776.1|
Domain Number 1 Region: 159-230
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000228
Family Transglutaminase, two C-terminal domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110667965|ref|YP_657776.1|
Sequence length 530
Comment hypothetical protein HQ2017A [Haloquadratum walsbyi DSM 16790]
Sequence
MKQSGRRQRMAILTIVVLLLLTVFASGVAIGVPAARVAVSDATVTPATPTAGAPTTVTAT
VRLSGGSTSAVTLDRVELVSSDDDNFRDDVVARATDLGSLSAGETLTVPITATFDTPGEH
DLRIRATVTDADNDETTVTRPISVIVEQGVPQVSFDAPNAVVGADSSVQATVSNPTNAAL
RNLSVRIMTPETGERSVREIPVLAAGTTTTLNLSVQPRQPGQQQLTADISYLTPSGTVQT
VDETELMRVKPLANDVGVRVSRSTGNNQNNAGGVAGGIGGILGGQSDLQAGGSQQDGAEQ
GEVDVTVSNFGNAPIDSVVVIPQTANGTIVTEIGRVIVDETLSPGTASTVTVDTAQAEQI
GQLRFAAAYELAGERHTVSAKFNRQTPGAVDLTGVDLSVKSNGSVDLRSNLANTGGSEIS
GVVVQVVSSEYVTPEYPRRSYFVGTLGSSEFAPVELTASVDVQNATEVPVRIQYTVGADR
VVETTTISLPPNDETDGTTPGGGEVGVILSVLLVGAVIVISGVFIMRRRE
Download sequence
Identical sequences Q18IM5
gi|110667965|ref|YP_657776.1| WP_011571286.1.31310 362976.HQ2017A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]