SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110668094|ref|YP_657905.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110668094|ref|YP_657905.1|
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-18
Family ATP-dependent protease Lon (La), catalytic domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110668094|ref|YP_657905.1|
Sequence length 140
Comment ATP-dependent Lon-type protease, partial [Haloquadratum walsbyi DSM 16790]
Sequence
MKTSFETACDYLQANIRELTRDETLDDYDLNVQVLNPSDAGEGKETSVGFLVGIVSGILD
RSVRPQTIVLGAMSLMGELVAVSSLVDKLQLAVDSGANSVLLPAENKSDIAKIPNELLDE
LQLMSYTDPLDAASKAININ
Download sequence
Identical sequences Q18I96
362976.HQ2153A gi|110668094|ref|YP_657905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]