SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110668831|ref|YP_658642.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110668831|ref|YP_658642.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.69e-34
Family Translational machinery components 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110668831|ref|YP_658642.1|
Sequence length 132
Comment 30S ribosomal protein S9P [Haloquadratum walsbyi DSM 16790]
Sequence
MVTNTSGKKKTAIARATVREGKGRVRIDSQPVELVEPEMSRLKMLEPFRIAGEDLRSQVD
IDVSVSGGGFAGQADATRTAIARGLVQYLNDAELRDAYMDFDRSLLVNDVRQSEPKKWGG
PGARARYQKSYR
Download sequence
Identical sequences G0LM04 Q18G59 U1N894
WP_011572152.1.31310 WP_011572152.1.96088 362976.HQ2938A gi|110668831|ref|YP_658642.1| gi|385804349|ref|YP_005840749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]