SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|110669200|ref|YP_659011.1| from Haloquadratum walsbyi DSM 16790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110669200|ref|YP_659011.1|
Domain Number 1 Region: 3-148
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.87e-32
Family GHMP Kinase, N-terminal domain 0.0000592
Further Details:      
 
Domain Number 2 Region: 157-274
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.62e-25
Family Homoserine kinase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110669200|ref|YP_659011.1|
Sequence length 293
Comment homoserine kinase [Haloquadratum walsbyi DSM 16790]
Sequence
MRMETVRAPATSANLGSGFDVFGVALDRPADIVRVERADKTTIEVTGVGSQYIPEDPHSN
VVGAVAEALDAPAQIQIDKGVRPSSGLGSSAASAAAAAVALNGLYDRGLSRTELVPIAAE
GEAIVSGEAHVDNVAPALLGGFTIARNSTVTTVDTTIPLVACLPEIAVSTRDARRVVPDS
ITMEEAVHTVGSAATLTVGMCQSNPALVGAGMDEHVVTPARAELVTGYDTVREAALTAGA
TGVTVSGAGPAILAVCKAERRRAVAAAMIDAFETADVEARAYQTCVSAGATLF
Download sequence
Identical sequences 362976.HQ3322A gi|110669200|ref|YP_659011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]