SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146299191|ref|YP_001193782.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146299191|ref|YP_001193782.1|
Domain Number 1 Region: 51-259
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.71e-63
Family DNA/RNA non-specific endonuclease 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146299191|ref|YP_001193782.1|
Sequence length 265
Comment DNA/RNA non-specific endonuclease [Flavobacterium johnsoniae UW101]
Sequence
MKNALICFLAAFMAFSCKKENNVIHTDDKEEIGQKQSSFVSDQSNNTGSLYSVSYEPTST
TNQIVKHKYYTLSYNEKFEQAEWVAYELKKEYLKNGNFKRPYFIEDPKVTTGSADWRNYK
KSGYDKGHLCPAGDMEFSEEAYNDTFYTSNISPQKHDFNSGIWNRIEQKTRYWAGKYNDI
YVVTGGVLKDTDKKIGTEKVSVPKYFYKIVLAKSGKEHKAIAFLVPNKDSDKSIYDFVVP
IETVEKMTGIDFFPNLKNLKNSKDF
Download sequence
Identical sequences A5FK04
WP_012023511.1.25392 WP_012023511.1.49882 WP_012023511.1.53833 376686.Fjoh_1431 gi|146299191|ref|YP_001193782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]