SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302402|ref|YP_001196993.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302402|ref|YP_001196993.1|
Domain Number 1 Region: 24-122
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.000000000000589
Family Intron-encoded homing endonucleases 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146302402|ref|YP_001196993.1|
Sequence length 194
Comment NUMOD4 domain-containing protein [Flavobacterium johnsoniae UW101]
Sequence
MPHNRFYPNEVFKEIEINASLQLKYAISNRGRLISFTDEIENGRILKGGLSDGYPTFRFK
VKKDDKIINKYLFLYKLVAQYFIPKDSEDQTYVLHLDYNRSNDDVSNLRWATKQEMMAHS
RKSPRVIQAKKNLIEHNLKADGRKLTTTKVMLIKKILARPEQKTRLKMIAKQFGVSEMQI
RRIASGENWGHVKV
Download sequence
Identical sequences A0A1M5IQ62 A5FAU1
gi|146302402|ref|YP_001196993.1| 376686.Fjoh_4675 WP_012026640.1.25392 WP_012026640.1.26696 WP_012026640.1.49882 WP_012026640.1.53833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]