SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302448|ref|YP_001197039.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302448|ref|YP_001197039.1|
Domain Number 1 Region: 30-260
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.89e-45
Family Endonuclease I 0.00097
Further Details:      
 
Domain Number 2 Region: 274-351
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-16
Family Fibronectin type III 0.00027
Further Details:      
 
Weak hits

Sequence:  gi|146302448|ref|YP_001197039.1|
Domain Number - Region: 352-445
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.000929
Family Lamin A/C globular tail domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146302448|ref|YP_001197039.1|
Sequence length 617
Comment endonuclease I [Flavobacterium johnsoniae UW101]
Sequence
MKKNYFFLFLLVFTSAFSQIPTGYYDTATGTGYALKTQLYNIIKDHTDNGYGGLYVTYAT
SDLDHFYENDGTVLDMYSENPTGTDPYSYSIATTQRCGNYVKEGDCYNREHIIPQSVFDE
KSPMVADAHFITPTDGKVNGMRSNYPHGVVNNPTYTSLNGSKLGANATAGYSGTVFEPID
EFKGDIARMYFYFATRYENTIAGYSYPMFNGTSNKVFTAAFLNILLAWHTQDPVSPREIE
RNNAIYARQNNRNPFIDHPEYVNQIWTTESDDTTPPTTPQNLTVTQSTSNSISLSWSAST
DNSGIAAYAIYVDNVFKQNTTSTTATISGLTPSTTYSFYVIAKDASNNSSTQSTSVNGTT
TEASSGGGGTVTNEIFFTEYVEGSGNNKYLEISNFTGNTVDLTKYAIKKQVNGAGPWTST
SGLALTGTLAHGASYVIAYSQAAAACFAPASANLSSGATELQFNGNDPVGLFKNDVLIDI
IGTLGNTANFSIDETLRRKPTVSSPNTIFDKAAEWDVYPKDTCSGLGSHTLANLGTGNFD
SAIFSIYPNPSNGHFTIQLKDSNETSNIEIISILGQRVFSQKNSLNSSINVNNIQKGIYI
VRITQGSKTSSKKIIIN
Download sequence
Identical sequences A5FAP8
WP_012026686.1.25392 WP_012026686.1.49882 WP_012026686.1.53833 gi|146302448|ref|YP_001197039.1| 376686.Fjoh_4721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]