SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146302450|ref|YP_001197041.1| from Flavobacterium johnsoniae UW101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302450|ref|YP_001197041.1|
Domain Number 1 Region: 30-260
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 8.12e-45
Family Endonuclease I 0.0011
Further Details:      
 
Domain Number 2 Region: 272-368
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000238
Family Fibronectin type III 0.0000444
Further Details:      
 
Weak hits

Sequence:  gi|146302450|ref|YP_001197041.1|
Domain Number - Region: 380-452
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.0523
Family Lamin A/C globular tail domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146302450|ref|YP_001197041.1|
Sequence length 614
Comment endonuclease I [Flavobacterium johnsoniae UW101]
Sequence
MKKNYFLLVLLFSIIGFSQIPSGYYNTATGTGYTLKTQLYNIIKDHTNNGYAGLYTTYLT
SDVDNFYENDGTILDMYSENPSGTDPYNYTTGTTQRCGNYSAEGDCYNREHIIPQSVFNE
QSPMVADAHFITPTDGKVNGMRSNYPHGTVNSATYTSQNGSKLGSSSVSGYSGTVFEPIN
AFKGDIARMYFYFATRYENTVAGYSYAMFNGSSNQVFTTAFLNMLLAWHAQDPVSAREIA
RNNAIYARQNNRNPFIDHPEYVNQIWGGTSSTDTQAPTAPTSLASTSKTAVSISLSWNAS
TDNVAVTGYDVYANSAYKTTVSGTTATITGLTASTAYSIYVKAKDAAGNASASSNTISVT
TNSSGTGTATDLLFSEYIEGSGNNKALEIANNTGSSVSLSAYTIKKQTNGAGSWSTGLAL
TGTLATGSKFVIVNSSMSSSCFPTSSANISTTATELTFNGNDAVGLFKNGVLIDIIGTFN
GGTANFAADVTLRRKSTVTSPSTTFNLSAQWDSFSQDTCNNLGSKMARPIEEEVVETSDE
IVIFPNPSDGNFNIGLNNFNFPYSLEIFSFTGQKVFEKQNASDSIISVSYLPSGIYIVKI
EKDSKTTIKKIIIN
Download sequence
Identical sequences A5FAQ0
WP_012026688.1.25392 WP_012026688.1.49882 WP_012026688.1.53833 gi|146302450|ref|YP_001197041.1| 376686.Fjoh_4723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]