SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|529065288|ref|YP_008374451.1| from Cycloclasticus zancles 7-ME

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529065288|ref|YP_008374451.1|
Domain Number 1 Region: 245-527
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-62
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 2 Region: 7-237
Classification Level Classification E-value
Superfamily PP2C-like 5.36e-50
Family PP2C-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529065288|ref|YP_008374451.1|
Sequence length 567
Comment Serine/threonine protein kinase [Cycloclasticus zancles 7-ME]
Sequence
MQSESIIDLGQSSDKGLKTDNEDSYGVLLPESPVLEQKGVAAVIADGVSGCDAGKLASES
CVKSLLGDYYCTPDTWTVKTSVQKVLTATNRWMLGMAQQGGANQKGLATTMSALVVKSST
VHLFHIGDTRIYRIRDKQLELLTDDHRFWVSKEKNYLTRAIGIDLHLEIDYSHFLLEEGD
TFLFTTDGVHEFVSDNIMLAQVNNNTDNFDRAARNITDLAMKNGSHDNVTCQIVRFNQRP
HVNEQEIYRKLTELPFPPDLSAGMTLDGYRIERELHASNRTQVYLATDIQTQQQVVIKTP
SVNYVDDPTFLDMFVQEEWIGRRIDNNHVLKIIEQTRTRRFLYYVTEYIEGQTLRHWMSD
NPQPSLHDVRGIVRQIARGLRAFHKKEMIHQDLKPENIIIDTQGTVKIIDFGSTKVAGVE
EIASPIQRLNLLGTQHYTAPEYLLGQPASYRSDAFSLGVITYEMLTGKLPFGEKYGEKAL
SKLHYIPILEIDTDIPLWIDGAIRKIVNKKPSNRYEEISEFIHDLSHPNKLFTTAVHTPL
VERNPLAFWKAVALLSLFSNAALLLIK
Download sequence
Identical sequences S5TGU2
gi|529065288|ref|YP_008374451.1| WP_020932771.1.1351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]