SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529065290|ref|YP_008374453.1| from Cycloclasticus zancles 7-ME

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529065290|ref|YP_008374453.1|
Domain Number 1 Region: 249-534
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-59
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 
Domain Number 2 Region: 6-240
Classification Level Classification E-value
Superfamily PP2C-like 1.44e-47
Family PP2C-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529065290|ref|YP_008374453.1|
Sequence length 573
Comment Serine/threonine protein kinase [Cycloclasticus zancles 7-ME]
Sequence
MTNRLNISVGQYSDKGKKDINQDFHGVYIPDEPMLTSKGIAVVLSDGISSSDVSHIASES
SVSGFISDYYCTSETWSVKQSAERVLRATNSWLYAQSQQSTHRFNKDRGYVCTCSAMVIK
SRTTHIFHVGDSRVYRLNDQSLEQLTNDHRLWVAEGKSYLSRAMGVKQQLDIDYQSMAVA
EGDTFFLATDGVYEFVNDAFIVNTINEHADQLDEAAKLIVNTAYEQGSDDNLTAQIIRID
ALPDHETSELYQHITELPFAPLLDARMTMDGYRIIRAIHQSSRSHVYLALDDDTGEQVVI
KTPSVDLRDDSAYLERFTMEEWIARRINNAHVLKPCKQSRKRNYLYLAMEFIEGQTLKQW
MIDNPTPDLETVRGIIEQVAKGLRAFHRLEMLHQDLRPDNIMIDSTGTVKIIDFGSTRVA
GIMDISSSRQQDDILGTAQYTAPEYFLGQSGTSRSDLFSLGVITYQMLTGRLPYGVDVAR
CKSKSAQNKLNYKTVLDDEKEIPVWFDDVLKKAVHPDPYKRYGELSEFIFDLRQPNKEFI
NKTRPPLMERDPVLFWKSTTLMLTILVLYLLSQ
Download sequence
Identical sequences S5T8Y6
gi|529065290|ref|YP_008374453.1| WP_020932772.1.1351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]