SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126178325|ref|YP_001046290.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126178325|ref|YP_001046290.1|
Domain Number 1 Region: 187-434
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.43e-115
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000268
Further Details:      
 
Domain Number 2 Region: 3-186
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 8.63e-72
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126178325|ref|YP_001046290.1|
Sequence length 434
Comment methyl-coenzyme M reductase, beta subunit [Methanoculleus marisnigri JR1]
Sequence
MAKYTETIDLYSDDGKLLKSGVALDRISPLVNPATGKIIDLTKRTISVNLGGIQDALKVG
KLGKGKIKGRELDLPIMENKDAIVAKIKEMIQVEEGDDTEIMEFNGGKLLLVQVPTKRLV
NASTYDAAITSVAAATTFSIVDQFNIDAFNASTVKAACWGSYPHTQDMEGALVTSILTIP
QNNEGIGYALRNIPVNHTVMMTGRNALQGAALSSTLETAGIFEMGSAVGPFERAQLLAYA
YQGLNANNMVYDLVKANGQNGTVGTVVQSLVERAIEDKVIAPGKKGGYFQFYDTKDPMLW
NAYAAAGTMAATIVNCGAGRFAQAVSATLLYFNDLLEHETGLPSTDYGRVMGTAVGFSFF
SHSIYGGGGPGIFNGNHVVTRHANGVAIPCVVAAAALDAGTQMFSPESTSKLFADTYGKI
DVFNKPIDQIANGA
Download sequence
Identical sequences A3CSF8
368407.Memar_0375 gi|126178325|ref|YP_001046290.1| WP_011843218.1.74427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]