SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126178328|ref|YP_001046293.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126178328|ref|YP_001046293.1|
Domain Number 1 Region: 280-567
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 6.8e-144
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000234
Further Details:      
 
Domain Number 2 Region: 5-279
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.2e-142
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126178328|ref|YP_001046293.1|
Sequence length 568
Comment coenzyme-B sulfoethylthiotransferase [Methanoculleus marisnigri JR1]
Sequence
MAKIERSQKLFLKALKEKFQGQDVESETAEFYNFNGVRQSPRKMEFMKASRAVEMDRGIS
MYDPERCHLGGIPMGQRQLMTYEVSGTGVFVEGDDLHFVNNSAMQQMWDDIRRTVIVGMD
LAHQTLQKRLGKEVTPETINEYLHILNHAMPGGAVVQEHMVETHPGLVDDCYVKVFTGDQ
ELADDIEPQFLLNIEKLFPAKQAEELKAEVGKSMYQAIHIPTAVSRTCDGGTTSRWSAMQ
IGMSFIAAYRMCAGEAAVADLSYAAKHAGVVQMGSILPARRARGPNEPGGIKFGLFSDII
QANRKYPNDPAKASLEVVGAGTMLYDQIWLGSYMSGGVGFTQYATAAYTDNILDEFTYYG
MDYAKDKYKVDWKNPSPSDKVKPTQEIVNDLATEVTLNAMEQYEQFPTMMEDHFGGSQRA
GVIAAASGLTTSITTGNSNAGLNGWYLSMLLHKDGWSRLGFFGYDLQDQCGSANSLSMVS
DRGLMGELRGPNYPNYAMNVGHQGEYAAIVGGSHYGRGDAFCYSPLVKVCFADPSLRFDF
AEPRREFAKGAIREFMPAGERSLIIPAR
Download sequence
Identical sequences A3CSG1
368407.Memar_0378 gi|126178328|ref|YP_001046293.1| WP_011843221.1.74427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]