SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126178512|ref|YP_001046477.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126178512|ref|YP_001046477.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 4.97e-119
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126178512|ref|YP_001046477.1|
Sequence length 280
Comment F420-dependent methylenetetrahydromethanopterin dehydrogenase [Methanoculleus marisnigri JR1]
Sequence
MVVKVGIAKLGNIASGVMGELLLDERADREDMITFMATSGTKLQPEDIERVVSNMKAWGP
DFCIVVSPNGVLPGPTQAREDLAAAGIPCIVITDDVTTKKEQFEALKASNFGYIIMKADA
MIGARREFLDPIEMADYNGNLVKVLALTGAFRKMQMELDKVIDQVKAGKKGADLALPKVV
MTSDKAVDGEFSNPYALAKARAAYEIAQSVAGVNVKGCFMTKEWEKYIPIVASAHEMMRQ
AMLLCEEARTLEKGVDAVIRKPHKKTGEIVSKTALISKPE
Download sequence
Identical sequences A3CSZ5
gi|126178512|ref|YP_001046477.1| WP_011843405.1.100442 WP_011843405.1.74427 368407.Memar_0562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]