SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126178623|ref|YP_001046588.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126178623|ref|YP_001046588.1|
Domain Number 1 Region: 54-419
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.04e-32
Family Chondroitinase B 0.045
Further Details:      
 
Domain Number 2 Region: 796-855
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000017
Family Type I dockerin domain 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|126178623|ref|YP_001046588.1|
Domain Number - Region: 371-517
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000338
Family Pectate lyase-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126178623|ref|YP_001046588.1|
Sequence length 857
Comment APHP domain-containing protein [Methanoculleus marisnigri JR1]
Sequence
MRDRRTMKLLIAAFLIVGLIPIVGALEATPTTIVAASDSSAADKAAAAYVCDGVNDHVEI
QAALNALPSSGGVVLLSSGTYNCAGIIAPKAGSTLKGEGESETNLVFTRDGRINVDREYI
TLDGFHVKGTGYSSGVKWLGVITIRASHAKIHSITGTADASIQAVYLLIHDPTVYAPTLE
DVEFVNCKAVDTGTYGFLHNAWGSTNKVIKDVRYDNCAAINCGKYGQFNPWITGFDFAEL
NDMDGLRVTNCLAEGNLESGFHFEFDPKVTNAVLENCVSINNGQKPFPTKAYNPNDMSTH
YFGCGYYAPNCDVTFINCTAEGNSMNGFYTTNGGKLYNCVEKDTGIGRTDFSYRVPAGYY
SIPTRSVNPSTVMENCTSINSNGYGLQVDLANNVKIRNFHLVDPIGYNGKGSSLGGTNGQ
FDNSEVSIYASGNRVETLVWAKENVNTVFSGQIVSDAAKPFVIEGYRTKNVLVKDMEIVS
KTLPAGSPGVTIVSTVPAGQATLQNVKVTSTGSPVPTPTPTPTVPTTPAPSGKPDLVVTD
ISWTPANPVAGDAVTMKATIKNQGDAPTPAGTKHGIIVTFDDGAAGPGVWSDTYTKSIAP
GAWVTLTANGGSAGATWKAVEGTHTVKAHVDDVNRIAESNEANNVRSEQIKVSKAASGPT
PTPTPTPTPAGKPDLVVTDISWTPANPAAGDAATMKATIKNQGDAPTPAGTKHGVLFTFD
DGVAGPGVWSDTYTKSIAPGTWVTLTASGGSAGATWKAVEGTHTVKAHVDDVNRIAESVE
NNNVMSKEIVVGGLPVPVRGDLNGDGNVDWADVTIAAGMAQKTAPSDPAADVNGDGTVDW
KDVALLADFFFGRTSSL
Download sequence
Identical sequences A3CTA6
gi|126178623|ref|YP_001046588.1| WP_011843517.1.74427 368407.Memar_0673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]