SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126178966|ref|YP_001046931.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126178966|ref|YP_001046931.1|
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Vng1086c-like 1.27e-28
Family Vng1086c-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126178966|ref|YP_001046931.1|
Sequence length 94
Comment hypothetical protein Memar_1016 [Methanoculleus marisnigri JR1]
Sequence
MHKEELIALHGILTEIKDFFELQNQELKFSQYYALKIDPSQVHKSKMEHKYAIFVLGTEL
ANAMKDVEFSSSGRISARMKELAEKTLKEIEYLQ
Download sequence
Identical sequences A0A2I0NTF2 A3CU99
WP_011843860.1.74427 368407.Memar_1016 gi|126178966|ref|YP_001046931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]