SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126179204|ref|YP_001047169.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126179204|ref|YP_001047169.1|
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-31
Family Canonical RBD 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126179204|ref|YP_001047169.1|
Sequence length 86
Comment RNP-1 like RNA-binding protein [Methanoculleus marisnigri JR1]
Sequence
MESNKLYVGNLTYSVNEEQLKELFSQYGTVNDVRVIERKGFGFVEMSSPEEAEAAKEALN
DTVFEGRTLKIDEARPPRPRNDFRRF
Download sequence
Identical sequences A3CUY7
368407.Memar_1256 WP_011844098.1.74427 gi|126179204|ref|YP_001047169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]