SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126179872|ref|YP_001047837.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126179872|ref|YP_001047837.1|
Domain Number 1 Region: 6-245
Classification Level Classification E-value
Superfamily Aquaporin-like 3.27e-59
Family Aquaporin-like 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126179872|ref|YP_001047837.1|
Sequence length 247
Comment MIP family channel protein [Methanoculleus marisnigri JR1]
Sequence
MTISLGKRCVAEAVGTFILVFFGAGAAVVTLMLAAGTTPATPFNIGIGALGGLGDWLAIG
LAFGIAIAGSIYAFGRISGCHINPAVTIALFATRRLPGRDVVPYIAAQLIGAAAASLLFA
WAVGPDAVTIGGLGATAPFVGIGYLQAIVIEAIGTFLLMLVIMGAAVDERATPGFAGLVV
GLAVAGIITTIGNLTGASLNPARTFGPYLGDWLLAGQNLWEFFPIYIIGPIVGAVLAAFL
YDYVCCE
Download sequence
Identical sequences A3CWV5
368407.Memar_1929 WP_011844764.1.74427 gi|126179872|ref|YP_001047837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]