SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126180190|ref|YP_001048155.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126180190|ref|YP_001048155.1|
Domain Number 1 Region: 16-215
Classification Level Classification E-value
Superfamily eIF4e-like 3.92e-35
Family BLES03-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126180190|ref|YP_001048155.1|
Sequence length 216
Comment hypothetical protein Memar_2250 [Methanoculleus marisnigri JR1]
Sequence
MEEIDPEPLAEVAYGIFEVYLNREIRLRGPYLFELIEQGADFEADVREIFGRFEEDYPEL
AEALLRRFGGIDAIYAPLREGEGILPSKTTRMYWIVQDAPAPSGRGLDDDQVGKWLIFVA
AGEVDEAWQKVRDETVKGTLGISAKVSTAKPNPDSRDERSVIYVYTRDWADEADVMRVRE
RLRELGFTERIGYKRNIETYKGEYSEEGRKVTYYSA
Download sequence
Identical sequences A3CXS3
368407.Memar_2250 gi|126180190|ref|YP_001048155.1| WP_011845082.1.74427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]