SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126180374|ref|YP_001048339.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|126180374|ref|YP_001048339.1|
Domain Number - Region: 431-527
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0012
Family Anti-sigma factor antagonist SpoIIaa 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126180374|ref|YP_001048339.1|
Sequence length 549
Comment sulphate transporter [Methanoculleus marisnigri JR1]
Sequence
MPAGETNWRRSLPADLAAGATTALVGIPQGMGFALVAGVNPVYGLYTAAFSTAIGALLTG
SSYLKVMLSNVLAVSIYSVLAPVPEADVPATLFVLTILVGAFQLGFGLLRAGSLTRFIST
AVLTGFVTGAALLIVLGQLGNLTGYRLPREAIQVLAIPELLLHAGEIQPQALFVGLLTIS
LALALQRVPRLTSFSLLLPVIIAALLVRTAFPGVALVGDIAAIPAGLPAPVVPDLALAPG
LLIPALALAIIGLVMAVGVTETTPEPDGSIADVNRDFSGQGITNILTSFLQCAPSAGSLS
ATALNVAAGAETRAANLISGILVGAVIVVAGPLAEQIPLPALAGILILIGAELMNQPHVI
ACIWRYSRPGRWAMLATFISTQVLPLQYSIYIGVLLSLAIYLVTSTREATVVRLAPVEGG
MFREEPAPERLLDDSITVLSVSGSVYFATLRAIERSLPSPGGAESAVVILALPRRVEAGT
GLFRMLTRYARKVTAGGNRLILAEVNPRLLAGLEEGGVVEAIGPGNIFPATPVIGESLRA
AIRAAKAGT
Download sequence
Identical sequences A3CYA7
368407.Memar_2436 WP_011845266.1.74427 gi|126180374|ref|YP_001048339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]