SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126180377|ref|YP_001048342.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126180377|ref|YP_001048342.1|
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.28e-26
Family Sfri0576-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126180377|ref|YP_001048342.1|
Sequence length 127
Comment hypothetical protein Memar_2439 [Methanoculleus marisnigri JR1]
Sequence
MLEGMATGAENVVGFRFDGEMTAGDYDVTLIPALEDAKRSHPVLRILFHIVSFHGWKPHG
YWEKLKDWPGMEKVDRIAIVGGEKWEEWMNHLPGLFTGFTGIDVRYFTEGHLDTAIGWLR
EPIPAEL
Download sequence
Identical sequences A3CYB0
gi|126180377|ref|YP_001048342.1| WP_011845269.1.74427 368407.Memar_2439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]