SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126180380|ref|YP_001048345.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126180380|ref|YP_001048345.1|
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.63e-26
Family Sfri0576-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126180380|ref|YP_001048345.1|
Sequence length 131
Comment UspA domain-containing protein [Methanoculleus marisnigri JR1]
Sequence
MLDRMKESSGSVLGFRFDGKLSESDYATVLIPELERAIEEHQNVRILLKIEGFRSWRPGE
GWDAFKQWPGMEQVDRIAVVGGERWREWMNHLPGLFVGFDGVDVRYFPETRLRDAWGWLR
EGLVVTAPRAA
Download sequence
Identical sequences A3CYB3
gi|126180380|ref|YP_001048345.1| 368407.Memar_2442 WP_011845272.1.74427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]