SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126180405|ref|YP_001048370.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126180405|ref|YP_001048370.1|
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.3e-25
Family Anti-sigma factor antagonist SpoIIaa 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126180405|ref|YP_001048370.1|
Sequence length 118
Comment anti-sigma-factor antagonist [Methanoculleus marisnigri JR1]
Sequence
MSGHFEITEEKAGTVDIVTMKGRLDAGSSETAQERINRVLDAGGRNLLVNLCDLDYISSS
GLRVLLATLKRLKTNGGALRIACAQPQILEVFTMAGFHRIFSLSPDEATALAGFPAGS
Download sequence
Identical sequences A3CYD8
WP_011845297.1.74427 gi|126180405|ref|YP_001048370.1| 368407.Memar_2467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]