SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126178564|ref|YP_001046529.1| from Methanoculleus marisnigri JR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126178564|ref|YP_001046529.1|
Domain Number 1 Region: 6-252
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 4.71e-123
Family Methyl-coenzyme M reductase gamma chain 0.0000000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126178564|ref|YP_001046529.1|
Sequence length 254
Comment methyl-coenzyme M reductase, gamma subunit [Methanoculleus marisnigri JR1]
Sequence
MAYKPQYGPGTSKVAANRRKQMDPNQKLEKMRDVTDEDIVLILGHRAPGAAYPTAHPPLA
EQQEPDCPIRKIVTPTEGAKAGDRVRYIQFADSMFFAPSQPYQRTYTECYRFRGIDPGTL
SGRQIVECRERDLEKYSKELIETELLDPARTGIRGATVHGHSLRLAENGMMFDMLQRSVL
GEDGIVRYVKNQIGEPLDRAVAVGKPLDEKWLKAHTTIFHSLGGSAYRDDKEYIEYVQRI
HTLRTKYGFLPKEA
Download sequence
Identical sequences A3CT47
gi|126178564|ref|YP_001046529.1| WP_011843457.1.74427 368407.Memar_0614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]