SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116623167|ref|YP_825323.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116623167|ref|YP_825323.1|
Domain Number 1 Region: 1240-1522
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.73e-58
Family Complement components 0.0012
Further Details:      
 
Domain Number 2 Region: 868-950
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000000589
Family Rhamnogalacturonase B, RhgB, middle domain 0.012
Further Details:      
 
Domain Number 3 Region: 1606-1726
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.00000000000327
Family Alpha-macroglobulin receptor domain 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|116623167|ref|YP_825323.1|
Domain Number - Region: 365-421
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000863
Family Pre-dockerin domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116623167|ref|YP_825323.1|
Sequence length 1737
Comment alpha-2-macroglobulin domain-containing protein [Candidatus Solibacter usitatus Ellin6076]
Sequence
MKKTSKSFLLAAALIVIAAGVMLYSLQDAQAAPGDGLAATYTGGTLRVTIPYRGLHAGGG
TLTVEVLDPEDGVLGRSERRVEAGEGTGTFREEVTLAKALPVDEVVWNRVRYRFRYAEQK
DAAAQGRESISEILRTPVVHILGQQAYQMGGAAAVRVIVTDSKNEAIPGNGTVRIELAAP
GDHAQALFMGRLNRRGTTEAQFRLPAHVAGNYQMRYVVDTPIGSTEFTQAVRIEQKAAIL
LTTEKPIYQPGQTIHVRALALDQANHEATAGRKLTLEVEDSRGNKVFKKLTQTDGFGVAS
AEFGLADEVNLGTYHVRALMDGGSTAEIALNVERYVLPKFKVAVEFAGKDKEQHAKRGYR
PGDHVTGTVRANYFFGKPVDGAEIAVKGSAMDVGVVEAGSAHGKTDSDGVYRFDLQLPGY
FAGLPLHQGTARVLIEATVKDGAGHSETRGEPITVSDSPLILTAIPEGGTLIPGLDNQVF
VLASYPDGTPARAGLKIRVTGAAEQSARTDGGGVAVVQVRAAAETRSLQVEAVDQEGNHA
SSVVPMELRQGGDQVLLRTERAVYRAGDRVQVKVFSTRERGTAYLDVVKSGQTMLTRDVD
LVNGQAELTLPVTPDLAGAVDFSAYVFGRDARPVGDHRLIFVQPADDLKIEASADSPVYK
PGDEARVRFRVTNTKGEGVQAALGLQVVDEAVFALAEKRPGFAKVFFYLEQQVMKPRYEI
HSIGMPDIVEPVTEAKAAQRDRGARVLFAATEAVSGNKFETEIGRTIPTTKLAAYTGRYR
ARFEEQAKALVAHNSPAPQDAWGTALRIDRQQQRYYLVRSAGPDKQFNTADDLAAYLHVE
TRKIAGPPISAEMNVEIAMEHDRGSFNGMAEVTGSLKDSTGAAVSGATIAVQAGGGTART
AKSNEAGQFTLAGLAPGPYQLRVSSPGFKVAERAVTLKARDRAVVSVVLSVGGTTEAIVV
TAAIGTGRGGGMGFGAGIAGGVLGGIIGGVPRAMPMAAPMAMMEVADRRNFNTATVVKKE
KDSVVGGAAPHVRSYFPEALYINPEIVTDREGRASVVIPMADSITTWRMAMMASTAHGAL
GSGTGSLKVFQDFFVDLDLPVTLTQGDRVSIPVAAYNYAGGAGKVSLQLKNDDWFAMVED
TAAKTLDVDAGKVGGTQFTIEAKRIGKFQLTLSARMAGGVNRADIVVREIEVVPNGRERN
LVFNGRLESFVRHDVTFPATAIPEAGKIFVRLYPGPLSQVMEGMDAILRMPGGCFEQTSS
STYPNVLALDYMKRTKKLTPEVHAKAEGYIANGYQRLLTFEVAGGGFSWFGNPPANKILT
SYGLMEFSDMAKVHDVDANVIRRTQEWLAGQQQADGSWKPDTQFINEGATNRYNSDVTRI
TAYIAWALGNTGYQGPAAAQARQYVDRQMNAKLDTYTLAVIANFAVDYGKDREFTQRAMQ
LLLDARTEKGEQAWWTAEETGVFASGESASVETTALAAQALLKWGGAPGMAGKALGYIAS
KKDAQGTWGTTQATIMALRAMLLSTEKSASDVRGTVEVTLNGRTVETLTLNADNNDLLHQ
FVLKGVNSAGANAVGLKFAGKGSLAYQVVGRHFVPWEDREPNEALSISVNYDRTRLAQDD
VATATATVKNKLRNVAKMVMVDLGIPPGFDLLSEDLQSYQEKSAGRKSGRLEKFSLTATQ
AILYFDSIGAGETVTLNFRLRAKYPIKARTFQSRVYEYYNPDVNAVARPVQMEIRKK
Download sequence
Identical sequences Q01Z77
WP_011685792.1.46729 gi|116623167|ref|YP_825323.1| 234267.Acid_4073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]