SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116620247|ref|YP_822403.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116620247|ref|YP_822403.1|
Domain Number 1 Region: 93-211
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000518
Family Laminin G-like module 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116620247|ref|YP_822403.1|
Sequence length 262
Comment hypothetical protein Acid_1124 [Candidatus Solibacter usitatus Ellin6076]
Sequence
MKPITRTAALLFALTASAFAADHKVDLKAEQVGKPPVTFEPMVGTWVVAQDGPEKVIMID
GRPWVASKDNPTKLLLQTARKLYGTSNEELMDNAKQFAYYPVAVLKGVDNFSDGTITMKF
KTVAGDSDRCSGILFNVKPNGDWLAVRYNDTENNVALWEFHNGIRRNMKFSDRAKPFPLD
RAAWHELKLVVDGADLKAYLDGAAAIEYTLGSEPQAGRRGPPNEDLYPKNNPVLRPPVAG
KVGLWSKTDSTSYFKDYVVSPK
Download sequence
Identical sequences Q02A08
234267.Acid_1124 WP_011682894.1.46729 gi|116620247|ref|YP_822403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]