SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116622862|ref|YP_825018.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116622862|ref|YP_825018.1|
Domain Number 1 Region: 32-105
Classification Level Classification E-value
Superfamily E set domains 0.0000000014
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.016
Further Details:      
 
Domain Number 2 Region: 121-171
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000222
Family Collagen-binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116622862|ref|YP_825018.1|
Sequence length 668
Comment peptidase domain-containing protein [Candidatus Solibacter usitatus Ellin6076]
Sequence
MKRLSIVFVLAITVLAQPAKKAPAPQLIEPVQPVLAWIFPAGGQRGTTVEITASGTSIVP
ESVLVTGGGVSGKVLDGSVAARVKLSLTIAPDAAPGERELRILNAGGISNRFRFIVGELP
EIREIEPNNEKTTAQKLPALPLVVDGQILDNDRDYFRFTAKAGETLVFSVQARSLLPFIA
DAVPGWFDPQLTVYDKSGKQVAFADDNRFLPDPAMFFKPPADGDYTLELRDIVYRGRGDF
VYRMTMGALPFYTDVFPLGGRRGDEVAVEYRGVNLRETHGSVTVPAGAARTLTVHGLPFG
ASDYAAVREAEVNDAFERAQRLTAPVVVDGRVQKPGVSHYFVLTAKKDEKLVLEVQARRL
GSPLDSVLTLFDAKRNQVAENDDWSDPLEAALAHNADSRILYTFPAAGDYYLRLRDIQQK
GGEEYSFRLSVAPPHPDFTLRISPDNPRMGQGDTAAITVTAVRHDDFAGEIKLRVEKLPG
GYLASEALIPAGQNEGRLTVTSPTGAPVGILSPVVTGMAMVGKDTVMHRAESAESLMQAF
AYTHVLPTSQLFLAVIPGTGYTLSSNAPEGKVLEVKPESETPIVIKVLRKESVKAGVTIT
AVRLANNTITTKGVFVAPEKDEAEIVLTVSKDAKVGLRQDVIVSGLMRAGSQSIVRFARA
IPIQVVAK
Download sequence
Identical sequences Q020D2
234267.Acid_3763 gi|116622862|ref|YP_825018.1| WP_011685492.1.46729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]