SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116626591|ref|YP_828747.1| from Candidatus Solibacter usitatus Ellin6076

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116626591|ref|YP_828747.1|
Domain Number 1 Region: 629-792
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.01e-41
Family Histidine kinase 0.00046
Further Details:      
 
Domain Number 2 Region: 431-555
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-24
Family Flavin-binding PAS domain 0.074
Further Details:      
 
Domain Number 3 Region: 272-439
Classification Level Classification E-value
Superfamily GAF domain-like 1.18e-21
Family GAF domain 0.0061
Further Details:      
 
Domain Number 4 Region: 161-269
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.34e-16
Family PYP-like 0.05
Further Details:      
 
Domain Number 5 Region: 561-637
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000961
Family Homodimeric domain of signal transducing histidine kinase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116626591|ref|YP_828747.1|
Sequence length 796
Comment multi-sensor signal transduction histidine kinase [Candidatus Solibacter usitatus Ellin6076]
Sequence
MMASSLSLDRDSLIVLHAPVGRDAQLLHGLFDGARLQSKICQSIHELCREVECGVAAVFV
TEEALDPIAIESLSAVLQEQGAWSDLPLVVLTVGGEPTQAIRERLTRLEPLGDLTLLERP
LRSDTIVSAARTALRARAKQYEVRRRDAELQLVTDNVPVLISYIDGDEVYRRVNQTYHEW
FGVPADDVVGMSVREFNGEAYYAAAQPYIACALGGQRVSFEAQLLDKNCELREVIISFAP
DIGLDRTVRGIISLVQDITERKRTERALRASGQRLQFLSELSEATRALTDPALVMAIIAR
MTGEHLRASRCAYADVEPDSEIFTIQHDYTERGCRSTVGTYRLSSFGPRFAAEMREGRTV
VIRNVGQELGQGAGAAMFQRIGIEAIVCCPLVKDHKLVAMMAVHQTSPRDWTADEVGVVE
TVVDRSWASIERTRAQNALRASEEQFRTLADTIPNLAWMAYADGHTFWYNQRWYDYTGST
PEAMQGWGWQSVHDAEVLPEVLHGWKNSIATGEPFEMVYPLKRADGVYRLFLTRVAPVRD
SSGVVVRWFGTSTDIDDQKRSEEALRRANCELEEFAYVASHDLQEPLRMVNVYTQLLLKR
LGPQASLQLQEYADYVAAGVKRMDVLIRDLLTYSRVTHTDDDPTLLRADLGAALRQAIMS
VKTRMQENHAEVTADFLPMVAADEGQLGHVFQNLLSNALKYRKRNETPRIHVAARRRDGH
WVVSVADNGIGFDPEHSDRIFGLFKRLHREDEYPGTGLGLAICKRIVERYRGRIWAQSEP
GAGSTFFISLPGVTNE
Download sequence
Identical sequences Q01PF8
WP_011689177.1.46729 gi|116626591|ref|YP_828747.1| 234267.Acid_7554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]