SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119382994|ref|YP_914050.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119382994|ref|YP_914050.1|
Domain Number 1 Region: 92-225
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.88e-29
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000554
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119382994|ref|YP_914050.1|
Sequence length 228
Comment GntR family transcriptional regulator [Paracoccus denitrificans PD1222]
Sequence
MTSRTKDQPRPKGRSIQRPGRLGDEVYEALYAQLMALEIPPGARISVDNLVRELGVSQTP
IREALSRLEAQGLVVKTHLIGYSAASQIDEQRLEQLYDLRLLLEPYAAGRAAVHMDDDDI
ARLVALDARMDEIHPDGKESYGEFAAADGQFHDLIAQGSGNELVRDALSRLYTHVHLFRL
FYLASVTAEANDEHAAIVAAIVARDSAAAEEAMRRHVLESRKRFTGRR
Download sequence
Identical sequences A1AYL0
WP_011746587.1.25907 WP_011746587.1.3707 WP_011746587.1.52749 gi|119382994|ref|YP_914050.1| 318586.Pden_0240 2005312657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]