SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119383786|ref|YP_914842.1| from Paracoccus denitrificans PD1222

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119383786|ref|YP_914842.1|
Domain Number 1 Region: 107-309
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.33e-38
Family Phosphate binding protein-like 0.02
Further Details:      
 
Domain Number 2 Region: 21-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.32e-19
Family LysR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119383786|ref|YP_914842.1|
Sequence length 317
Comment LysR family transcriptional regulator [Paracoccus denitrificans PD1222]
Sequence
MKTPNPAPRDAVEREGDLPSVSALRAFVMAAQFRSFSRAADELDITQSGISRAVRSIEDM
AGTQLFERTGHGLVLTEPGSVYYDEITSILSELGAATLRLSTYAEAADQLTIATLPSLGG
RWLAPRIGRFIAQNPAIEVSITAQIGHFDFEGSSIDAAIHYGNEVWAGCLSEMLMDEVLI
PFCAPALLRGTVPQARLLLDLPLIQHLHRPTAWREWFREVGIEHPNPTRGMRFEQYQMGI
EAAKTGLGAILMPPFMVSEEIQNGQLVALHNLPVASPWRYYLVYPKAKRSKPAVQKFRSW
IRAEARRSLQQTAQMIG
Download sequence
Identical sequences A1B0V2
gi|119383786|ref|YP_914842.1| 318586.Pden_1035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]